How Is a Protein Sequence Represented?

A protein sequence is a polypeptide chain composed of amino acids, where each amino acid is linked to its neighboring amino acids through specific chemical bonds, forming a linear peptide chain. Protein sequences are commonly represented using single-letter abbreviations for each amino acid, such as "A" for Alanine and "K" for Lysine. This representation facilitates protein description, comparison, search, and storage.

 

A standard protein sequence representation is as follows:

 

Protein Name

MKTGAFSQDPAVADLSYGRSIVHNGYLEFDVPRAFSCEYDRIKLVSEPLLENYQHRLQVDIADGGVQMQYAGCDAERAPDRVLQSLLGKEDAAQLARDAEETWR

 

Here, MKTGAFSQDPAVADLSYGRSIVHNGYLEFDVPRAFSCEYDRIKLVSEPLLENYQHRLQVDIADGGVQMQYAGCDAERAPDRVLQSLLGKEDAAQLARDAEETWR represents a protein’s amino acid sequence, where each letter corresponds to a specific amino acid.

 

Protein sequences can be represented in various formats, including single-letter and three-letter abbreviations, depending on the requirements and usage scenarios.

 

MtoZ Biolabs, an integrated chromatography and mass spectrometry (MS) services provider.

Related Services

Protein Sequencing