How Is a Protein Sequence Represented?

    A protein sequence is a polypeptide chain composed of amino acids, where each amino acid is linked to its neighboring amino acids through specific chemical bonds, forming a linear peptide chain. Protein sequences are commonly represented using single-letter abbreviations for each amino acid, such as "A" for Alanine and "K" for Lysine. This representation facilitates protein description, comparison, search, and storage.

     

    A standard protein sequence representation is as follows:

     

    Protein Name

    MKTGAFSQDPAVADLSYGRSIVHNGYLEFDVPRAFSCEYDRIKLVSEPLLENYQHRLQVDIADGGVQMQYAGCDAERAPDRVLQSLLGKEDAAQLARDAEETWR

     

    Here, MKTGAFSQDPAVADLSYGRSIVHNGYLEFDVPRAFSCEYDRIKLVSEPLLENYQHRLQVDIADGGVQMQYAGCDAERAPDRVLQSLLGKEDAAQLARDAEETWR represents a protein’s amino acid sequence, where each letter corresponds to a specific amino acid.

     

    Protein sequences can be represented in various formats, including single-letter and three-letter abbreviations, depending on the requirements and usage scenarios.

     

    MtoZ Biolabs, an integrated chromatography and mass spectrometry (MS) services provider.

    Related Services

    Protein Sequencing

Submit Inquiry
Name *
Email Address *
Phone Number
Inquiry Project
Project Description *

 

How to order?


Submit Your Request Now ×
/assets/images/icon/icon-message.png

Submit Inquiry

/assets/images/icon/icon-return.png